Lineage for d2y9la_ (2y9l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780030Species Hypocrea lixii [TaxId:5544] [194314] (3 PDB entries)
  8. 2780031Domain d2y9la_: 2y9l A: [304708]
    automated match to d1q2ba_
    complexed with nag, pe4

Details for d2y9la_

PDB Entry: 2y9l (more details), 1.67 Å

PDB Description: Cellobiohydrolase I Cel7A from Trichoderma harzianum at 1.7 A resolution
PDB Compounds: (A:) exoglucanase 1

SCOPe Domain Sequences for d2y9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9la_ b.29.1.10 (A:) automated matches {Hypocrea lixii [TaxId: 5544]}
eqvctqqaethppltwqkctasgctpqqgsvvldanwrwthdtksttncydgntwsstlc
pddatcaknccldganysgtygvttsgdaltlqfvtasnvgsrlylmandstyqeftlsg
nefsfdvdvsqlpcglngalyfvsmdadggqskypgnaagakygtgycdsqcprdlkfin
gqanvegwepssnnantgvgghgsccsemdiweansisealtphpcetvgqtmcsgdscg
gtysndryggtcdpdgcdwnpyrlgntsfygpgssfaldttkkltvvtqfatdgsisryy
vqngvkfqqpnaqvgsysgntintdycaaeqtafggtsftdkgglaqinkafqggmvlvm
slwddyavnmlwldstyptnatastpgakrgscstssgvpaqveaqspnskviysnirfg
pigstgg

SCOPe Domain Coordinates for d2y9la_:

Click to download the PDB-style file with coordinates for d2y9la_.
(The format of our PDB-style files is described here.)

Timeline for d2y9la_: