Lineage for d2y02b_ (2y02 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023273Family f.13.1.3: Amine receptor-like [310610] (3 proteins)
  6. 3023286Protein automated matches [310862] (2 species)
    not a true protein
  7. 3023289Species Turkey (Meleagris gallopavo) [TaxId:9103] [311259] (12 PDB entries)
  8. 3023299Domain d2y02b_: 2y02 B: [304688]
    automated match to d2vt4b_
    complexed with 2cv, na, whj, y01; mutant

Details for d2y02b_

PDB Entry: 2y02 (more details), 2.6 Å

PDB Description: turkey beta1 adrenergic receptor with stabilising mutations and bound agonist carmoterol
PDB Compounds: (B:) beta-1 adrenergic receptor

SCOPe Domain Sequences for d2y02b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y02b_ f.13.1.3 (B:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
aellsqqweagmsllmalvvllivagnvlviaaigstqrlqtltnlfitslacadlvvgl
lvvpfgatlvvrgtwlwgsflcelwtsldvlcvtasietlcviaidrylaitspfryqsl
mtrarakviictvwaisalvsflpimmhwwrdedpqalkcyqdpgccdfvtnrayaiass
iisfyipllimifvalrvyreakeqirkidraskrktsrvmlmrehkalktlgiimgvft
lcwlpfflvnivnvfnrdlvpdwlfvafnwlgyansamnpiiycrspdfrkafkrlla

SCOPe Domain Coordinates for d2y02b_:

Click to download the PDB-style file with coordinates for d2y02b_.
(The format of our PDB-style files is described here.)

Timeline for d2y02b_: