SCOPe 2.08: Domain d2y00b_: 2y00 B:

Lineage for d2y00b_ (2y00 B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.3: Amine receptor-like [310610] (3 proteins)

6. Protein automated matches [310862] (2 species)
   not a true protein

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [311259] (12 PDB entries)

8. Domain d2y00b_: 2y00 B: [304684]
   automated match to d2vt4b_
   complexed with 2cv, na, y00, y01; mutant

Details for d2y00b_

PDB Entry: 2y00, 2.5 Å

PDB Description: turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist dobutamine (crystal dob92)

PDB Compounds: (B:) beta-1 adrenergic receptor

SCOPe Domain Sequences for d2y00b_:

Sequence; same for both SEQRES and ATOM records:

>d2y00b_ f.13.1.3 (B:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
aellsqqweagmsllmalvvllivagnvlviaaigstqrlqtltnlfitslacadlvvgl
lvvpfgatlvvrgtwlwgsflcelwtsldvlcvtasietlcviaidrylaitspfryqsl
mtrarakviictvwaisalvsflpimmhwwrdedpqalkcyqdpgccdfvtnrayaiass
iisfyipllimifvalrvyreakeqirkidraskrktsrvmlmrehkalktlgiimgvft
lcwlpfflvnivnvfnrdlvpdwlfvafnwlgyansamnpiiycrspdfrkafkrlla

Timeline for d2y00b_:

• d2y00b_ first appeared in SCOPe 2.06
  
• d2y00b_ appears in SCOPe 2.07