| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) ![]() Pfam PF13853. Phylogeny described in PubMed 12761335 |
| Family f.13.1.3: Amine receptor-like [310610] (3 proteins) |
| Protein automated matches [310862] (2 species) not a true protein |
| Species Turkey (Meleagris gallopavo) [TaxId:9103] [311259] (12 PDB entries) |
| Domain d2y00b_: 2y00 B: [304684] automated match to d2vt4b_ complexed with 2cv, na, y00, y01; mutant |
PDB Entry: 2y00 (more details), 2.5 Å
SCOPe Domain Sequences for d2y00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y00b_ f.13.1.3 (B:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
aellsqqweagmsllmalvvllivagnvlviaaigstqrlqtltnlfitslacadlvvgl
lvvpfgatlvvrgtwlwgsflcelwtsldvlcvtasietlcviaidrylaitspfryqsl
mtrarakviictvwaisalvsflpimmhwwrdedpqalkcyqdpgccdfvtnrayaiass
iisfyipllimifvalrvyreakeqirkidraskrktsrvmlmrehkalktlgiimgvft
lcwlpfflvnivnvfnrdlvpdwlfvafnwlgyansamnpiiycrspdfrkafkrlla
Timeline for d2y00b_: