SCOPe 2.08: Domain d2xxeb1: 2xxe B:22-164

Lineage for d2xxeb1 (2xxe B:22-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [311257] (2 PDB entries)

8. Domain d2xxeb1: 2xxe B:22-164 [304674]
   Other proteins in same PDB: d2xxea2, d2xxeb2, d2xxec2, d2xxed2
   automated match to d2v7pa1
   mutant

Details for d2xxeb1

PDB Entry: 2xxe, 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxeb1:

Sequence, based on SEQRES records:

>d2xxeb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records):

>d2xxeb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlldrnaqvfaqvvprvleaapeavllvatnpvdvm
tqvayrlsglppgrvvgsg

Timeline for d2xxeb1:

• d2xxeb1 first appeared in SCOPe 2.06
  
• d2xxeb1 appears in SCOPe 2.07