Lineage for d2xxeb1 (2xxe B:22-164)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096171Species Thermus thermophilus [TaxId:300852] [311257] (1 PDB entry)
  8. 2096173Domain d2xxeb1: 2xxe B:22-164 [304674]
    Other proteins in same PDB: d2xxea2, d2xxeb2, d2xxec2, d2xxed2
    automated match to d2v7pa1
    mutant

Details for d2xxeb1

PDB Entry: 2xxe (more details), 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxeb1:

Sequence, based on SEQRES records: (download)

>d2xxeb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d2xxeb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlldrnaqvfaqvvprvleaapeavllvatnpvdvm
tqvayrlsglppgrvvgsg

SCOPe Domain Coordinates for d2xxeb1:

Click to download the PDB-style file with coordinates for d2xxeb1.
(The format of our PDB-style files is described here.)

Timeline for d2xxeb1:

  • d2xxeb1 is new in SCOPe 2.06-stable