| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [311257] (2 PDB entries) |
| Domain d2xxea1: 2xxe A:22-164 [304672] Other proteins in same PDB: d2xxea2, d2xxeb2, d2xxec2, d2xxed2 automated match to d2v7pa1 mutant |
PDB Entry: 2xxe (more details), 3 Å
SCOPe Domain Sequences for d2xxea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxea1 c.2.1.0 (A:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg
Timeline for d2xxea1: