Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.18: MGS-like [142691] (2 proteins) contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array |
Protein Mannosylglycerate synthase, MGS [142692] (1 species) |
Species Rhodothermus marinus [TaxId:29549] [142693] (9 PDB entries) Uniprot Q9RFR0 2-382 |
Domain d2xw5b_: 2xw5 B: [304671] automated match to d2bo4a1 complexed with cl, edo, gdx, mg |
PDB Entry: 2xw5 (more details), 2.7 Å
SCOPe Domain Sequences for d2xw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xw5b_ c.68.1.18 (B:) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede rvrrrsdwgidtlytfvtvaagvsiyecyipegkahrlygglddlrtmlvecfaaiqslq hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd yaqqylyrmlgryryqaale
Timeline for d2xw5b_: