Lineage for d2xw5b_ (2xw5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899189Family c.68.1.18: MGS-like [142691] (2 proteins)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 2899190Protein Mannosylglycerate synthase, MGS [142692] (1 species)
  7. 2899191Species Rhodothermus marinus [TaxId:29549] [142693] (9 PDB entries)
    Uniprot Q9RFR0 2-382
  8. 2899202Domain d2xw5b_: 2xw5 B: [304671]
    automated match to d2bo4a1
    complexed with cl, edo, gdx, mg

Details for d2xw5b_

PDB Entry: 2xw5 (more details), 2.7 Å

PDB Description: mannosylglycerate synthase in complex with mg-gdp-mannose
PDB Compounds: (B:) mannosylglycerate synthase

SCOPe Domain Sequences for d2xw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xw5b_ c.68.1.18 (B:) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvaagvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaale

SCOPe Domain Coordinates for d2xw5b_:

Click to download the PDB-style file with coordinates for d2xw5b_.
(The format of our PDB-style files is described here.)

Timeline for d2xw5b_: