![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.18: MGS-like [142691] (2 proteins) contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array |
![]() | Protein Mannosylglycerate synthase, MGS [142692] (1 species) |
![]() | Species Rhodothermus marinus [TaxId:29549] [142693] (9 PDB entries) Uniprot Q9RFR0 2-382 |
![]() | Domain d2xw2a_: 2xw2 A: [304664] automated match to d2bo4a1 complexed with lac, trs |
PDB Entry: 2xw2 (more details), 2.3 Å
SCOPe Domain Sequences for d2xw2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xw2a_ c.68.1.18 (A:) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} mslvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtp vsvrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadf gyglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyed ervrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqsl qhevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvreg lrtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgy dyaqqylyrmlgryryqaalen
Timeline for d2xw2a_: