![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein automated matches [190670] (7 species) not a true protein |
![]() | Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries) |
![]() | Domain d2xunh_: 2xun H: [304659] Other proteins in same PDB: d2xuna2, d2xunb2, d2xunc2, d2xund2, d2xunf2, d2xung2 automated match to d2xzwa_ complexed with akg, atp, mg |
PDB Entry: 2xun (more details), 1.95 Å
SCOPe Domain Sequences for d2xunh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xunh_ d.58.5.1 (H:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna
Timeline for d2xunh_: