Lineage for d2xunf1 (2xun F:1-112)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2517842Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 protein domains)
  6. 2517918Protein automated matches [190670] (6 species)
    not a true protein
  7. 2517957Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries)
  8. 2517964Domain d2xunf1: 2xun F:1-112 [304655]
    Other proteins in same PDB: d2xuna2, d2xunb2, d2xunc2, d2xund2, d2xunf2, d2xung2
    automated match to d2xzwa_
    complexed with akg, atp, mg

Details for d2xunf1

PDB Entry: 2xun (more details), 1.95 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
PDB Compounds: (F:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xunf1:

Sequence, based on SEQRES records: (download)

>d2xunf1 d.58.5.1 (F:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records): (download)

>d2xunf1 d.58.5.1 (F:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqterytveflqklkleivv
edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

SCOPe Domain Coordinates for d2xunf1:

Click to download the PDB-style file with coordinates for d2xunf1.
(The format of our PDB-style files is described here.)

Timeline for d2xunf1: