SCOPe 2.06: Domain d5grta1: 5grt A:18-165,A:291-363

Lineage for d5grta1 (5grt A:18-165,A:291-363)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Glutathione reductase [51944] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51945] (23 PDB entries)

8. Domain d5grta1: 5grt A:18-165,A:291-363 [30465]
   Other proteins in same PDB: d5grta3
   complexed with fad, ts4; mutant

Details for d5grta1

PDB Entry: 5grt, 2.4 Å

PDB Description: human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex

PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d5grta1:

Sequence; same for both SEQRES and ATOM records:

>d5grta1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
vasydylvigggsgglesawraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt
nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld

Timeline for d5grta1:

• d5grta1 first appeared (with stable ids) in SCOP 1.55, called d5grt_1
  
• d5grta1 appears in SCOPe 2.05
  
• d5grta1 appears in SCOPe 2.07
  
• d5grta1 appears in the current release, SCOPe 2.08