Lineage for d5grta1 (5grt A:18-165,A:291-363)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850017Protein Glutathione reductase, N- and C-terminal domain [418942] (3 species)
  7. 2850027Species Human (Homo sapiens) [TaxId:9606] [419396] (23 PDB entries)
  8. 2850050Domain d5grta1: 5grt A:18-165,A:291-363 [30465]
    Other proteins in same PDB: d5grta2, d5grta3
    complexed with fad, ts4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d5grta1

PDB Entry: 5grt (more details), 2.4 Å

PDB Description: human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d5grta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5grta1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vasydylvigggsgglesawraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt
nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld

SCOPe Domain Coordinates for d5grta1:

Click to download the PDB-style file with coordinates for d5grta1.
(The format of our PDB-style files is described here.)

Timeline for d5grta1: