Lineage for d2xpta4 (2xpt A:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728122Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2728123Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2728131Domain d2xpta4: 2xpt A:68-208 [304644]
    Other proteins in same PDB: d2xpta3, d2xpta5
    automated match to d1bjza2
    complexed with cl, k, tdc

Details for d2xpta4

PDB Entry: 2xpt (more details), 1.89 Å

PDB Description: TetR(D) in complex with anhydrotetracycline and potassium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpta4:

Sequence, based on SEQRES records: (download)

>d2xpta4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d2xpta4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtanlppllrealqimdsddgeqaflhgleslirgfe
vqltallqiv

SCOPe Domain Coordinates for d2xpta4:

Click to download the PDB-style file with coordinates for d2xpta4.
(The format of our PDB-style files is described here.)

Timeline for d2xpta4: