Lineage for d2xpta3 (2xpt A:3-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692448Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 2692449Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)
  8. 2692456Domain d2xpta3: 2xpt A:3-67 [304643]
    Other proteins in same PDB: d2xpta4, d2xpta5
    automated match to d1bjza1
    complexed with cl, k, tdc

Details for d2xpta3

PDB Entry: 2xpt (more details), 1.89 Å

PDB Description: TetR(D) in complex with anhydrotetracycline and potassium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpta3 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d2xpta3:

Click to download the PDB-style file with coordinates for d2xpta3.
(The format of our PDB-style files is described here.)

Timeline for d2xpta3: