Lineage for d2xpsa4 (2xps A:68-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341170Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2341171Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2341177Domain d2xpsa4: 2xps A:68-208 [304641]
    Other proteins in same PDB: d2xpsa3, d2xpsa5
    automated match to d1bjza2
    complexed with cl, mg, so4, tdc

Details for d2xpsa4

PDB Entry: 2xps (more details), 1.75 Å

PDB Description: TetR(D) in complex with anhydrotetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpsa4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOPe Domain Coordinates for d2xpsa4:

Click to download the PDB-style file with coordinates for d2xpsa4.
(The format of our PDB-style files is described here.)

Timeline for d2xpsa4: