Lineage for d3grta2 (3grt A:166-290)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458283Protein Glutathione reductase [51944] (3 species)
  7. 2458301Species Human (Homo sapiens) [TaxId:9606] [51945] (23 PDB entries)
  8. 2458345Domain d3grta2: 3grt A:166-290 [30464]
    Other proteins in same PDB: d3grta3
    complexed with fad, ts2; mutant

Details for d3grta2

PDB Entry: 3grt (more details), 2.5 Å

PDB Description: human glutathione reductase a34e, r37w mutant, oxidized trypanothione complex
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d3grta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grta2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOPe Domain Coordinates for d3grta2:

Click to download the PDB-style file with coordinates for d3grta2.
(The format of our PDB-style files is described here.)

Timeline for d3grta2: