SCOPe 2.07: Domain d2xipa1: 2xip A:112-311

Lineage for d2xipa1 (2xip A:112-311)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d2xipa1: 2xip A:112-311 [304638]
   Other proteins in same PDB: d2xipa2
   automated match to d2xwca_
   complexed with gol, ni, tam, zn

Details for d2xipa1

PDB Entry: 2xip, 1.82 Å

PDB Description: crystal structure of the dna binding domain of human tp73 refined at 1.8 a resolution

PDB Compounds: (A:) tumour protein p73

SCOPe Domain Sequences for d2xipa1:

Sequence, based on SEQRES records:

>d2xipa1 b.2.5.2 (A:112-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfe
gricacpgrdrkadedhyre

Sequence, based on observed residues (ATOM records):

>d2xipa1 b.2.5.2 (A:112-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvgrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyre

Timeline for d2xipa1:

• d2xipa1 first appeared in SCOPe 2.06
  
• d2xipa1 appears in the current release, SCOPe 2.08