Lineage for d2xdta4 (2xdt A:615-940)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006883Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 protein domains)
    Pfam PF11838; PubMed 15893768
  6. 2006884Protein ERAP1 C-terminal domain [254386] (1 species)
  7. 2006885Species Human (Homo sapiens) [TaxId:9606] [254819] (2 PDB entries)
  8. 2006886Domain d2xdta4: 2xdt A:615-940 [304637]
    Other proteins in same PDB: d2xdta1, d2xdta2, d2xdta3
    automated match to d2yd0a4
    complexed with edo, k, nag, zn

Details for d2xdta4

PDB Entry: 2xdt (more details), 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2xdta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xdta4 a.118.1.26 (A:615-940) ERAP1 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlqsekler

SCOPe Domain Coordinates for d2xdta4:

Click to download the PDB-style file with coordinates for d2xdta4.
(The format of our PDB-style files is described here.)

Timeline for d2xdta4:

  • d2xdta4 is new in SCOPe 2.06-stable