SCOPe 2.08: Domain d2xdta3: 2xdt A:530-614

Lineage for d2xdta3 (2xdt A:530-614)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)

6. Protein ERAP1 insert domain [254384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254817] (2 PDB entries)

8. Domain d2xdta3: 2xdt A:530-614 [304636]
   Other proteins in same PDB: d2xdta1, d2xdta2, d2xdta4
   automated match to d2yd0a3
   complexed with edo, k, nag, zn

Details for d2xdta3

PDB Entry: 2xdt, 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1

PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2xdta3:

Sequence, based on SEQRES records:

>d2xdta3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records):

>d2xdta3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgdtgylwhvpltfitsksdmvhrfllktktdvlilpee
vewikfnvgmngyyivhyed

Timeline for d2xdta3:

• d2xdta3 first appeared in SCOPe 2.06
  
• d2xdta3 appears in SCOPe 2.07