Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins) |
Protein ERAP1 insert domain [254384] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254817] (2 PDB entries) |
Domain d2xdta3: 2xdt A:530-614 [304636] Other proteins in same PDB: d2xdta1, d2xdta2, d2xdta4 automated match to d2yd0a3 complexed with edo, k, nag, zn |
PDB Entry: 2xdt (more details), 2.7 Å
SCOPe Domain Sequences for d2xdta3:
Sequence, based on SEQRES records: (download)
>d2xdta3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]} fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl ilpeevewikfnvgmngyyivhyed
>d2xdta3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]} fplititvrgrnvhmkqehymkgdtgylwhvpltfitsksdmvhrfllktktdvlilpee vewikfnvgmngyyivhyed
Timeline for d2xdta3: