Lineage for d2xdta2 (2xdt A:255-529)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530011Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 protein domains)
    adopts thermolysin-like fold
  6. 2530023Protein ERAP1 catalytic domain [254382] (1 species)
  7. 2530024Species Human (Homo sapiens) [TaxId:9606] [254815] (2 PDB entries)
  8. 2530025Domain d2xdta2: 2xdt A:255-529 [304635]
    Other proteins in same PDB: d2xdta1, d2xdta3, d2xdta4
    automated match to d2yd0a2
    complexed with edo, k, nag, zn

Details for d2xdta2

PDB Entry: 2xdt (more details), 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2xdta2:

Sequence, based on SEQRES records: (download)

>d2xdta2 d.92.1.13 (A:255-529) ERAP1 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm
dgfcsrsqhssssshwhqegvdvktmmntwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d2xdta2 d.92.1.13 (A:255-529) ERAP1 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasigvdvktmmn
twtlqkg

SCOPe Domain Coordinates for d2xdta2:

Click to download the PDB-style file with coordinates for d2xdta2.
(The format of our PDB-style files is described here.)

Timeline for d2xdta2: