Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries) |
Domain d2xaib_: 2xai B: [304631] Other proteins in same PDB: d2xaif_ automated match to d1lm8c_ complexed with cl, edo, peg |
PDB Entry: 2xai (more details), 2.58 Å
SCOPe Domain Sequences for d2xaib_:
Sequence, based on SEQRES records: (download)
>d2xaib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf tykvrytnssteipefpiapeialellmaanfldc
>d2xaib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei pefpiapeialellmaanfldc
Timeline for d2xaib_: