Lineage for d2x1yb2 (2x1y B:222-737)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097807Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
    automatically mapped to Pfam PF02867
  6. 2097808Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 2097809Species Escherichia coli [TaxId:562] [52004] (10 PDB entries)
  8. 2097811Domain d2x1yb2: 2x1y B:222-737 [304626]
    Other proteins in same PDB: d2x1ya1, d2x1yb1, d2x1yc1
    automated match to d2r1ra2

Details for d2x1yb2

PDB Entry: 2x1y (more details), 2.1 Å

PDB Description: ribonucleotide reductase y731no2y modified r1 subunit of e. coli to 2.1 a resolution
PDB Compounds: (B:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d2x1yb2:

Sequence, based on SEQRES records: (download)

>d2x1yb2 c.7.1.2 (B:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrdg

Sequence, based on observed residues (ATOM records): (download)

>d2x1yb2 c.7.1.2 (B:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspfhtgcipfykhfqt
avkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqinklmytrl
lkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfslmmqera
stgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeialctlsaf
nlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfayylakh
gkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpidtykkdl
dtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgyvsikas
kdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydpsrfpsg
kvpmqqllkdlltaykfgvktlyyqntrdg

SCOPe Domain Coordinates for d2x1yb2:

Click to download the PDB-style file with coordinates for d2x1yb2.
(The format of our PDB-style files is described here.)

Timeline for d2x1yb2:

  • d2x1yb2 is new in SCOPe 2.06-stable