Lineage for d2x1ya1 (2x1y A:4-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721200Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 2721201Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 2721202Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 2721203Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 2721204Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
    Uniprot Q08698
  8. 2721205Domain d2x1ya1: 2x1y A:4-221 [304623]
    Other proteins in same PDB: d2x1ya2, d2x1yb2, d2x1yc2
    automated match to d2r1ra1

Details for d2x1ya1

PDB Entry: 2x1y (more details), 2.1 Å

PDB Description: ribonucleotide reductase y731no2y modified r1 subunit of e. coli to 2.1 a resolution
PDB Compounds: (A:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d2x1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1ya1 a.98.1.1 (A:4-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
nllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetii
kaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledy
teeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsn
ypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d2x1ya1:

Click to download the PDB-style file with coordinates for d2x1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2x1ya1: