Lineage for d2x0mb_ (2x0m B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2090066Protein automated matches [196175] (7 species)
    not a true protein
  7. 2090086Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries)
  8. 2090088Domain d2x0mb_: 2x0m B: [304622]
    automated match to d4pc8a_
    complexed with 3pg

Details for d2x0mb_

PDB Entry: 2x0m (more details), 1.91 Å

PDB Description: crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase
PDB Compounds: (B:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d2x0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0mb_ c.1.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 5702]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

SCOPe Domain Coordinates for d2x0mb_:

Click to download the PDB-style file with coordinates for d2x0mb_.
(The format of our PDB-style files is described here.)

Timeline for d2x0mb_: