![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
![]() | Protein automated matches [196175] (9 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries) |
![]() | Domain d2x0mb_: 2x0m B: [304622] automated match to d4pc8a_ complexed with 3pg |
PDB Entry: 2x0m (more details), 1.91 Å
SCOPe Domain Sequences for d2x0mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0mb_ c.1.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 5702]} skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
Timeline for d2x0mb_: