SCOPe 2.08: Domain d4gr1a2: 4gr1 A:166-290

Lineage for d4gr1a2 (4gr1 A:166-290)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Glutathione reductase, middle domain [418943] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419397] (23 PDB entries)

8. Domain d4gr1a2: 4gr1 A:166-290 [30462]
   Other proteins in same PDB: d4gr1a1, d4gr1a3
   complexed with fad, po4, rgs

Details for d4gr1a2

PDB Entry: 4gr1, 2.4 Å

PDB Description: the binding of the retro-analogue of glutathione disulfide to glutathione reductase

PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d4gr1a2:

Sequence; same for both SEQRES and ATOM records:

>d4gr1a2 c.3.1.5 (A:166-290) Glutathione reductase, middle domain {Human (Homo sapiens) [TaxId: 9606]}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

Timeline for d4gr1a2:

• d4gr1a2 first appeared (with stable ids) in SCOP 1.55, called d4gr1_2
  
• d4gr1a2 appears in SCOPe 2.07