| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
| Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
| Protein automated matches [190672] (29 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [311252] (2 PDB entries) |
| Domain d2wzvb_: 2wzv B: [304618] automated match to d3gr3a_ complexed with fmn, gol, po4 |
PDB Entry: 2wzv (more details), 1.75 Å
SCOPe Domain Sequences for d2wzvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wzvb_ d.90.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
vdlaqaaerlikgrravrafrpdevpeetmravfelaghapsnsntqpwhvevvsgaard
rlaealvtahaeervtvdfpyreglfqgvlqerradfgsrlyaalgiardqtdllqgynt
eslrfygaphvamlfapnnteariagdmgiyaqtlmlamtahgiascpqallsfyadtvr
aelgvenrkllmgisfgyaddtaavngvripraglsettrfsr
Timeline for d2wzvb_: