Lineage for d2wzvb_ (2wzv B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204711Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2204712Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2204859Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2204860Protein automated matches [190672] (25 species)
    not a true protein
  7. 2204938Species Mycobacterium smegmatis [TaxId:246196] [311252] (2 PDB entries)
  8. 2204942Domain d2wzvb_: 2wzv B: [304618]
    automated match to d3gr3a_
    complexed with fmn, gol, po4

Details for d2wzvb_

PDB Entry: 2wzv (more details), 1.75 Å

PDB Description: crystal structure of the fmn-dependent nitroreductase nfnb from mycobacterium smegmatis
PDB Compounds: (B:) nfnb protein

SCOPe Domain Sequences for d2wzvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzvb_ d.90.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
vdlaqaaerlikgrravrafrpdevpeetmravfelaghapsnsntqpwhvevvsgaard
rlaealvtahaeervtvdfpyreglfqgvlqerradfgsrlyaalgiardqtdllqgynt
eslrfygaphvamlfapnnteariagdmgiyaqtlmlamtahgiascpqallsfyadtvr
aelgvenrkllmgisfgyaddtaavngvripraglsettrfsr

SCOPe Domain Coordinates for d2wzvb_:

Click to download the PDB-style file with coordinates for d2wzvb_.
(The format of our PDB-style files is described here.)

Timeline for d2wzvb_: