SCOPe 2.08: Domain d2wzvb_: 2wzv B:

Lineage for d2wzvb_ (2wzv B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [311252] (2 PDB entries)

8. Domain d2wzvb_: 2wzv B: [304618]
   automated match to d3gr3a_
   complexed with fmn, gol, po4

Details for d2wzvb_

PDB Entry: 2wzv, 1.75 Å

PDB Description: crystal structure of the fmn-dependent nitroreductase nfnb from mycobacterium smegmatis

PDB Compounds: (B:) nfnb protein

SCOPe Domain Sequences for d2wzvb_:

Sequence; same for both SEQRES and ATOM records:

>d2wzvb_ d.90.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
vdlaqaaerlikgrravrafrpdevpeetmravfelaghapsnsntqpwhvevvsgaard
rlaealvtahaeervtvdfpyreglfqgvlqerradfgsrlyaalgiardqtdllqgynt
eslrfygaphvamlfapnnteariagdmgiyaqtlmlamtahgiascpqallsfyadtvr
aelgvenrkllmgisfgyaddtaavngvripraglsettrfsr

Timeline for d2wzvb_:

• d2wzvb_ first appeared in SCOPe 2.06
  
• d2wzvb_ appears in SCOPe 2.07