Lineage for d2wt6a3 (2wt6 A:600-721)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2767066Superfamily b.1.31: Fibronectin III-like [254143] (2 families) (S)
    Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2)
  5. 2767081Family b.1.31.0: automated matches [254280] (1 protein)
    not a true family
  6. 2767082Protein automated matches [254649] (1 species)
    not a true protein
  7. 2767083Species Thermotoga neapolitana [TaxId:309803] [255676] (4 PDB entries)
  8. 2767087Domain d2wt6a3: 2wt6 A:600-721 [304616]
    Other proteins in same PDB: d2wt6a1, d2wt6a2
    automated match to d2x42a3
    complexed with br, gol

Details for d2wt6a3

PDB Entry: 2wt6 (more details), 2.31 Å

PDB Description: structural of beta-glucosidase 3b from thermotoga neapolitana in complex with glycerol
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2wt6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wt6a3 b.1.31.0 (A:600-721) automated matches {Thermotoga neapolitana [TaxId: 309803]}
yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt
rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf
kp

SCOPe Domain Coordinates for d2wt6a3:

Click to download the PDB-style file with coordinates for d2wt6a3.
(The format of our PDB-style files is described here.)

Timeline for d2wt6a3: