SCOPe 2.06: Domain d2wt5a3: 2wt5 A:600-721

Lineage for d2wt5a3 (2wt5 A:600-721)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.31: Fibronectin III-like [254143] (2 families)
   Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2)

5. Family b.1.31.1: Fibronectin III-like [254189] (1 protein)

6. Protein Beta-glucosidase C-terminal domain [254418] (2 species)

7. Species Thermotoga neapolitana [TaxId:309803] [254859] (2 PDB entries)

8. Domain d2wt5a3: 2wt5 A:600-721 [304613]
   Other proteins in same PDB: d2wt5a1, d2wt5a2
   automated match to d2x42a3
   complexed with br, glc; mutant

Details for d2wt5a3

PDB Entry: 2wt5, 2.1 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana: mutant d242a in complex with alpha-d-glucose

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2wt5a3:

Sequence; same for both SEQRES and ATOM records:

>d2wt5a3 b.1.31.1 (A:600-721) Beta-glucosidase C-terminal domain {Thermotoga neapolitana [TaxId: 309803]}
yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt
rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf
kp

Timeline for d2wt5a3:

• d2wt5a3 is new in SCOPe 2.06-stable
  
• d2wt5a3 appears in SCOPe 2.07
  
• d2wt5a3 appears in the current release, SCOPe 2.08