Lineage for d2wt5a2 (2wt5 A:320-599)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103295Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2103296Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 protein domains)
  6. 2103316Protein Beta-glucosidase middle domain [254416] (2 species)
  7. 2103326Species Thermotoga neapolitana [TaxId:309803] [254856] (2 PDB entries)
  8. 2103328Domain d2wt5a2: 2wt5 A:320-599 [304612]
    Other proteins in same PDB: d2wt5a1, d2wt5a3
    automated match to d2x42a2
    complexed with br, glc; mutant

Details for d2wt5a2

PDB Entry: 2wt5 (more details), 2.1 Å

PDB Description: structure of beta-glucosidase 3b from thermotoga neapolitana: mutant d242a in complex with alpha-d-glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2wt5a2:

Sequence, based on SEQRES records: (download)

>d2wt5a2 c.23.11.1 (A:320-599) Beta-glucosidase middle domain {Thermotoga neapolitana [TaxId: 309803]}
dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai
silegikerglnfdeelaktyedyikkmreteeykprrdswgtiikpklpenflsekeih
klakkndvavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllni
gspvevvswrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtf
pgepkdnpqkvvyeediyvgyryydtfgvepayefgygls

Sequence, based on observed residues (ATOM records): (download)

>d2wt5a2 c.23.11.1 (A:320-599) Beta-glucosidase middle domain {Thermotoga neapolitana [TaxId: 309803]}
dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai
silegikerglnfdeelaktyedyikkmreteeykprriikpklpenflsekeihklakk
ndvavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllnigspve
vvswrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtfpgepk
dnpqkvvyeediyvgyryydtfgvepayefgygls

SCOPe Domain Coordinates for d2wt5a2:

Click to download the PDB-style file with coordinates for d2wt5a2.
(The format of our PDB-style files is described here.)

Timeline for d2wt5a2:

  • d2wt5a2 is new in SCOPe 2.06-stable