![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.31: Fibronectin III-like [254143] (2 families) ![]() Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2) |
![]() | Family b.1.31.0: automated matches [254280] (1 protein) not a true family |
![]() | Protein automated matches [254649] (1 species) not a true protein |
![]() | Species Thermotoga neapolitana [TaxId:309803] [255676] (4 PDB entries) |
![]() | Domain d2wt3a3: 2wt3 A:600-721 [304610] Other proteins in same PDB: d2wt3a1, d2wt3a2 automated match to d2x42a3 complexed with bgc, br |
PDB Entry: 2wt3 (more details), 2.05 Å
SCOPe Domain Sequences for d2wt3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wt3a3 b.1.31.0 (A:600-721) automated matches {Thermotoga neapolitana [TaxId: 309803]} yttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhkt rllnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrf kp
Timeline for d2wt3a3: