Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) automatically mapped to Pfam PF01915 |
Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins) |
Protein automated matches [254648] (1 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [255675] (4 PDB entries) |
Domain d2wt3a2: 2wt3 A:320-599 [304609] Other proteins in same PDB: d2wt3a1, d2wt3a3 automated match to d2x42a2 complexed with bgc, br |
PDB Entry: 2wt3 (more details), 2.05 Å
SCOPe Domain Sequences for d2wt3a2:
Sequence, based on SEQRES records: (download)
>d2wt3a2 c.23.11.1 (A:320-599) automated matches {Thermotoga neapolitana [TaxId: 309803]} dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai silegikerglnfdeelaktyedyikkmreteeykprrdswgtiikpklpenflsekeih klakkndvavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllni gspvevvswrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtf pgepkdnpqkvvyeediyvgyryydtfgvepayefgygls
>d2wt3a2 c.23.11.1 (A:320-599) automated matches {Thermotoga neapolitana [TaxId: 309803]} dlekhakvayeagaegvvllrneealplsenskialfgtgqietikggtgsgdthpryai silegikerglnfdeelaktyedyikkmreteeykprriikpklpenflsekeihklakk ndvavivisrisgegydrkpvkgdfylsddetdliktvsrefheqgkkvivllnigspve vvswrdlvdgillvwqagqetgrivadvltgrinpsgklpttfprdysdvpswtfpgepk dnpqkvvyeediyvgyryydtfgvepayefgygls
Timeline for d2wt3a2: