Lineage for d2wt3a1 (2wt3 A:2-319)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440705Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2440743Protein automated matches [191056] (3 species)
    not a true protein
  7. 2440778Species Thermotoga neapolitana [TaxId:309803] [255674] (4 PDB entries)
  8. 2440780Domain d2wt3a1: 2wt3 A:2-319 [304608]
    Other proteins in same PDB: d2wt3a2, d2wt3a3
    automated match to d2x41a1
    complexed with bgc, br

Details for d2wt3a1

PDB Entry: 2wt3 (more details), 2.05 Å

PDB Description: structural of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose: a thermostable 3-domain representative of glycoside hydrolase family 3
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2wt3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wt3a1 c.1.8.7 (A:2-319) automated matches {Thermotoga neapolitana [TaxId: 309803]}
ekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgpa
glrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapamn
ihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdtiv
seralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvms
dwyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrnil
kvlvnapsfknyrysnkp

SCOPe Domain Coordinates for d2wt3a1:

Click to download the PDB-style file with coordinates for d2wt3a1.
(The format of our PDB-style files is described here.)

Timeline for d2wt3a1: