![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein automated matches [190916] (13 species) not a true protein |
![]() | Species Yersinia pseudotuberculosis [TaxId:633] [189541] (4 PDB entries) |
![]() | Domain d2wn1b_: 2wn1 B: [304606] automated match to d2wwoa_ complexed with azi, cu, mes, zn |
PDB Entry: 2wn1 (more details), 2.6 Å
SCOPe Domain Sequences for d2wn1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wn1b_ b.1.8.1 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]} kasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscapgm kdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlksls evkqhalmihaggdnysdhpmplggggarmacgvie
Timeline for d2wn1b_: