Lineage for d2wn0b_ (2wn0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764458Species Yersinia pseudotuberculosis [TaxId:633] [189541] (4 PDB entries)
  8. 2764462Domain d2wn0b_: 2wn0 B: [304604]
    automated match to d2wwoa_
    complexed with cu, gol, mes, zn

Details for d2wn0b_

PDB Entry: 2wn0 (more details), 2.4 Å

PDB Description: yersinia pseudotuberculosis superoxide dismutase c
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wn0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wn0b_ b.1.8.1 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
dkasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscapg
mkdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlksl
sevkqhalmihaggdnysdhpmplggggarmacgvie

SCOPe Domain Coordinates for d2wn0b_:

Click to download the PDB-style file with coordinates for d2wn0b_.
(The format of our PDB-style files is described here.)

Timeline for d2wn0b_: