SCOP 1.67: Domain d1bwca2: 1bwc A:166-290

Lineage for d1bwca2 (1bwc A:166-290)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Glutathione reductase [51944] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries)

8. Domain d1bwca2: 1bwc A:166-290 [30460]
   Other proteins in same PDB: d1bwca3
   complexed with aj3, cl, fad

Details for d1bwca2

PDB Entry: 1bwc, 2.1 Å

PDB Description: structure of human glutathione reductase complexed with ajoene inhibitor and subversive substrate

SCOP Domain Sequences for d1bwca2:

Sequence; same for both SEQRES and ATOM records:

>d1bwca2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

Timeline for d1bwca2:

• d1bwca2 first appeared (with stable ids) in SCOP 1.55
  
• d1bwca2 appears in SCOP 1.65
  
• d1bwca2 appears in SCOP 1.69
  
• d1bwca2 appears in the current release, SCOPe 2.08