SCOPe 2.08: Domain d2wmjb2: 2wmj B:841-1005

Lineage for d2wmjb2 (2wmj B:841-1005)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
   sandwich, 10 strands in 2 sheets; "folded meander"

4. Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families)
   C-terminal half of Pfam PF08307
   Slightly different topology from Hyaluronate lyase; contains helical insert

5. Family b.24.2.0: automated matches [310667] (1 protein)
   not a true family

6. Protein automated matches [310861] (2 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:406556] [311249] (13 PDB entries)

8. Domain d2wmjb2: 2wmj B:841-1005 [304598]
   Other proteins in same PDB: d2wmja1, d2wmjb1
   automated match to d2wmfa2

Details for d2wmjb2

PDB Entry: 2wmj, 2 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 (sp3gh98) in complex with the b-trisaccharide blood group antigen.

PDB Compounds: (B:) fucolectin-related protein

SCOPe Domain Sequences for d2wmjb2:

Sequence; same for both SEQRES and ATOM records:

>d2wmjb2 b.24.2.0 (B:841-1005) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
yegdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvn
lnnfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgid
klptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhf

Timeline for d2wmjb2:

• d2wmjb2 first appeared in SCOPe 2.06
  
• d2wmjb2 appears in SCOPe 2.07