Lineage for d2wmia1 (2wmi A:422-840)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114720Species Streptococcus pneumoniae [TaxId:406556] [311248] (13 PDB entries)
  8. 2114725Domain d2wmia1: 2wmi A:422-840 [304591]
    Other proteins in same PDB: d2wmia2, d2wmib2
    automated match to d2wmfa1

Details for d2wmia1

PDB Entry: 2wmi (more details), 1.9 Å

PDB Description: Crystal structure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 in complex with the A-trisaccharide blood group antigen.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmia1:

Sequence, based on SEQRES records: (download)

>d2wmia1 c.37.1.0 (A:422-840) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
vdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhpd
dlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstswi
dkmyqkypnlhgifstenywiwandienkaadylkvsaknggyfiwaeqnngsaiekafg
kngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwkw
yetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnnk
esllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtpl
ymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmn

Sequence, based on observed residues (ATOM records): (download)

>d2wmia1 c.37.1.0 (A:422-840) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
vdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhpd
dlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstswi
dkmyqkypnlhgifstenywiwandienkaadylkvsaknggyfiwaeqnngsaiekafg
kngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwkw
yetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnnk
esllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtpl
ymtgrynvipaipgvlktdiqikeitspefsstqarkeylnklypmn

SCOPe Domain Coordinates for d2wmia1:

Click to download the PDB-style file with coordinates for d2wmia1.
(The format of our PDB-style files is described here.)

Timeline for d2wmia1:

  • d2wmia1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmia2