Lineage for d2wmha1 (2wmh A:35-425)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870403Protein automated matches [190723] (8 species)
    not a true protein
  7. 2870432Species Streptococcus pneumoniae [TaxId:170187] [311250] (2 PDB entries)
  8. 2870433Domain d2wmha1: 2wmh A:35-425 [304589]
    Other proteins in same PDB: d2wmha2
    automated match to d2wmfa1

Details for d2wmha1

PDB Entry: 2wmh (more details), 1.7 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmha1 c.37.1.12 (A:35-425) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
vqmrttinnesplllsplygndngnglwwgntlkgaweaipedvkpyaaielhpakvckp
tsciprdtkelrewyvkmleeaqslnipvflvimsagerntvppewldeqfqkysvlkgv
lnienywiynnqlaphsakylevcakygahfiwhdhekwfwetimndptffeasqkyhkn
lvlatkntpirddagtdsivsgfwlsglcdnwgsstdtwkwwekhytntfetgrardmrs
yasepesmiamemmnvytgggtvynfecaaytfmtndvptpaftkgiipffrhaiqnpap
skeevvnrtkavfwngegrisslngfyqglysndetmplynngryhilpvihekidkeki
ssifpnakiltknseelsskvnylnslypkl

SCOPe Domain Coordinates for d2wmha1:

Click to download the PDB-style file with coordinates for d2wmha1.
(The format of our PDB-style files is described here.)

Timeline for d2wmha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmha2