SCOPe 2.08: Domain d2wmga2: 2wmg A:426-589

Lineage for d2wmga2 (2wmg A:426-589)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
   sandwich, 10 strands in 2 sheets; "folded meander"

4. Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families)
   C-terminal half of Pfam PF08307
   Slightly different topology from Hyaluronate lyase; contains helical insert

5. Family b.24.2.0: automated matches [310667] (1 protein)
   not a true family

6. Protein automated matches [310861] (2 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [311251] (2 PDB entries)

8. Domain d2wmga2: 2wmg A:426-589 [304588]
   Other proteins in same PDB: d2wmga1
   automated match to d2wmfa2

Details for d2wmga2

PDB Entry: 2wmg, 2.3 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.

PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmga2:

Sequence, based on SEQRES records:

>d2wmga2 b.24.2.0 (A:426-589) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlkg
htghkpqinisgdknhytytenwdenthvytitvnhngmvemki

Sequence, based on observed residues (ATOM records):

>d2wmga2 b.24.2.0 (A:426-589) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlkg
hhkpqinisgdknhytytenwdenthvytitvnhngmvemki

Timeline for d2wmga2:

• d2wmga2 first appeared in SCOPe 2.06
  
• d2wmga2 appears in SCOPe 2.07