SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wmfa2 (2wmf A:426-589)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041816Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2041873Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) (S)
    C-terminal half of Pfam PF08307
    Slightly different topology from Hyaluronate lyase; contains helical insert
  5. 2041874Family b.24.2.1: Glycosyl hydrolase family 98 C-terminal domain [310645] (1 protein)
  6. 2041875Protein Sp4GH98 [310791] (1 species)
  7. 2041876Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311049] (1 PDB entry)
  8. 2041877Domain d2wmfa2: 2wmf A:426-589 [304586]
    Other proteins in same PDB: d2wmfa1

Details for d2wmfa2

PDB Entry: 2wmf (more details), 1.5 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmfa2 b.24.2.1 (A:426-589) Sp4GH98 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlsg
htghkpqinisgdknhytytenwdenthvytitvnhngmvemsi

SCOPe Domain Coordinates for d2wmfa2:

Click to download the PDB-style file with coordinates for d2wmfa2.
(The format of our PDB-style files is described here.)

Timeline for d2wmfa2:

  • d2wmfa2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmfa1