Lineage for d2wk1a_ (2wk1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130545Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 protein domains)
    Pfam PF05711
  6. 2130576Protein S-adenosyl-L-methionine-dependent O-methyltransferase NovP [310828] (1 species)
  7. 2130577Species Streptomyces caeruleus [TaxId:195949] [311097] (1 PDB entry)
  8. 2130578Domain d2wk1a_: 2wk1 A: [304582]
    complexed with edo, sah, so4

Details for d2wk1a_

PDB Entry: 2wk1 (more details), 1.4 Å

PDB Description: structure of the o-methyltransferase novp
PDB Compounds: (A:) novp

SCOPe Domain Sequences for d2wk1a_:

Sequence, based on SEQRES records: (download)

>d2wk1a_ c.66.1.61 (A:) S-adenosyl-L-methionine-dependent O-methyltransferase NovP {Streptomyces caeruleus [TaxId: 195949]}
dsslyldlmikvlagtvyedpahrenfshrdstyreevrnegrdwpanahtmigikrlen
irqcvedvignnvpgdlvetgvwrggacilmrgilrahdvrdrtvwvadsfqgipdvged
gyagdrkmalhrrnsvlavseeevrrnfrnydlldeqvrflpgwfkdtlptapidtlavl
rmdgdlyestwdtltnlypkvsvggyvivddymmcppckdavdeyrakfdiadelitidr
dgvywqrtr

Sequence, based on observed residues (ATOM records): (download)

>d2wk1a_ c.66.1.61 (A:) S-adenosyl-L-methionine-dependent O-methyltransferase NovP {Streptomyces caeruleus [TaxId: 195949]}
dsslyldlmikvlagtvyedpahretyreevrnegrdwpanahtmigikrlenirqcved
vignnvpgdlvetgvwrggacilmrgilrahdvrdrtvwvadsfqgipdvgedgyagdrk
malhrrnsvlavseeevrrnfrnydlldeqvrflpgwfkdtlptapidtlavlrmdgdly
estwdtltnlypkvsvggyvivddymmcppckdavdeyrakfdiadelitidrdgvywqr
tr

SCOPe Domain Coordinates for d2wk1a_:

Click to download the PDB-style file with coordinates for d2wk1a_.
(The format of our PDB-style files is described here.)

Timeline for d2wk1a_:

  • d2wk1a_ is new in SCOPe 2.06-stable