Lineage for d2wirb_ (2wir B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136595Species Pyrobaculum calidifontis [TaxId:410359] [226193] (2 PDB entries)
  8. 2136597Domain d2wirb_: 2wir B: [304579]
    automated match to d2yh2a_
    complexed with trs

Details for d2wirb_

PDB Entry: 2wir (more details), 2 Å

PDB Description: hyperthermophilic esterase from the archeon pyrobaculum calidifontis
PDB Compounds: (B:) alpha/beta hydrolase fold-3 domain protein

SCOPe Domain Sequences for d2wirb_:

Sequence, based on SEQRES records: (download)

>d2wirb_ c.69.1.0 (B:) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
plspilrqilqqlaaqlqfrpdmdvktvreqfeksslilvkmanepihrveditipgrgg
pirarvyrprdgerlpavvyyhgggfvlgsvethdhvcrrlanlsgavvvsvdyrlapeh
kfpaavedaydaakwvadnydklgvdngkiavagdsaggnlaavtaimardrgesfvkyq
vliypavnltgsptvsrveysgpeyviltadlmawfgrqyfskpqdalspyaspifadls
nlppalvitaeydplrdegelyahllktrgvravavryngvihgfvnfypileegreavs
qiaasiksmava

Sequence, based on observed residues (ATOM records): (download)

>d2wirb_ c.69.1.0 (B:) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
plspilrqilqqldmdvktvreqfeksslilvkmanepihrveditipgrggpirarvyr
prdgerlpavvyyhgggfvlgsvethdhvcrrlanlsgavvvsvdyrlapehkfpaaved
aydaakwvadnydklgvdngkiavagdsaggnlaavtaimardrgesfvkyqvliypavn
ltgsptvsrveysgpeyviltadlmawfgrqyfskpqdalspyaspifadlsnlppalvi
taeydplrdegelyahllktrgvravavryngvihgfvnfypileegreavsqiaasiks
mava

SCOPe Domain Coordinates for d2wirb_:

Click to download the PDB-style file with coordinates for d2wirb_.
(The format of our PDB-style files is described here.)

Timeline for d2wirb_:

  • d2wirb_ is new in SCOPe 2.06-stable