Lineage for d2wh8a_ (2wh8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005739Species Mycobacterium tuberculosis [TaxId:83332] [226004] (12 PDB entries)
  8. 2005748Domain d2wh8a_: 2wh8 A: [304572]
    automated match to d4rm4a_
    complexed with hem, ii2

Details for d2wh8a_

PDB Entry: 2wh8 (more details), 1.7 Å

PDB Description: Interaction of Mycobacterium tuberculosis CYP130 with heterocyclic arylamines
PDB Compounds: (A:) putative cytochrome p450 130

SCOPe Domain Sequences for d2wh8a_:

Sequence, based on SEQRES records: (download)

>d2wh8a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
shefqlataetwpnpwpmyralrdhdpvhhvvppqrpeydyyvlsrhadvwsaardhqtf
ssaqgltvnygelemiglhdtppmvmqdppvhtefrklvsrgftprqvetveptvrkfvv
erleklrangggdivtelfkplpsmvvahylgvpeedwtqfdgwtqaivaanavdgattg
aldavgsmmayftglierrrtepaddaishlvaagvgadgdtagtlsilaftftmvtggn
dtvtgmlggsmpllhrrpdqrrlllddpegipdaveellrltspvqglartttrdvtigd
ttipagrrvlllygsanrderqygpdaaeldvtrcprniltfshgahhclgaaaarmqcr
valtellarcpdfevaesrivwsggsyvrrplsvpfrv

Sequence, based on observed residues (ATOM records): (download)

>d2wh8a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
shefqlataetwpnpwpmyralrdhdpvhhvvppqrpeydyyvlsrhadvwsaardhqtf
ssaqgltvnygelemiglhdtppmvmqdppvhtefrklvsrgftprqvetveptvrkfvv
erleklrangggdivtelfkplpsmvvahylgvpeedwtqfdgwtqaivaanagaldavg
smmayftglierrrtepaddaishlvaagvgadgdtagtlsilaftftmvtggndtvtgm
lggsmpllhrrpdqrrlllddpegipdaveellrltspvqglartttrdvtigdttipag
rrvlllygsanrderqygpdaaeldvtrcprniltfshgahhclgaaaarmqcrvaltel
larcpdfevaesrivwsggsyvrrplsvpfrv

SCOPe Domain Coordinates for d2wh8a_:

Click to download the PDB-style file with coordinates for d2wh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2wh8a_:

  • d2wh8a_ is new in SCOPe 2.06-stable