![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (17 species) not a true protein |
![]() | Species Crithidia fasciculata [TaxId:5656] [189994] (2 PDB entries) |
![]() | Domain d2w9kb_: 2w9k B: [304569] automated match to d2yk3a_ complexed with hec, so4 |
PDB Entry: 2w9k (more details), 1.55 Å
SCOPe Domain Sequences for d2w9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9kb_ a.3.1.1 (B:) automated matches {Crithidia fasciculata [TaxId: 5656]} araplppgdaargeklfkgraaqchtanqggangvgpnlyglvgrhsgtiegyayskana esgvvwtpdvldvylenpkkfmpgtkmsfagmkkpqeradviayletlkg
Timeline for d2w9kb_: