SCOPe 2.06: Domain d2w8ec_: 2w8e C:

Lineage for d2w8ec_ (2w8e C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d2w8ec_: 2w8e C: [304565]
   automated match to d2w8gc_

Details for d2w8ec_

PDB Entry: 2w8e, 1.9 Å

PDB Description: aplysia californica achbp in apo state

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2w8ec_:

Sequence, based on SEQRES records:

>d2w8ec_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d2w8ec_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhpepyidvnlvvkfrer

Timeline for d2w8ec_:

• d2w8ec_ is new in SCOPe 2.06-stable
  
• d2w8ec_ appears in SCOPe 2.07
  
• d2w8ec_ appears in the current release, SCOPe 2.08