Lineage for d2w8ec_ (2w8e C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074178Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2074216Domain d2w8ec_: 2w8e C: [304565]
    automated match to d2w8gc_

Details for d2w8ec_

PDB Entry: 2w8e (more details), 1.9 Å

PDB Description: aplysia californica achbp in apo state
PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2w8ec_:

Sequence, based on SEQRES records: (download)

>d2w8ec_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d2w8ec_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2w8ec_:

Click to download the PDB-style file with coordinates for d2w8ec_.
(The format of our PDB-style files is described here.)

Timeline for d2w8ec_:

  • d2w8ec_ is new in SCOPe 2.06-stable