Lineage for d2vy0a_ (2vy0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779112Protein Beta-1,3-glucanase [310824] (3 species)
    Pfam PF03935
  7. 2779115Species Pyrococcus furiosus [TaxId:2261] [311092] (1 PDB entry)
  8. 2779116Domain d2vy0a_: 2vy0 A: [304561]
    complexed with ca, cl, mpd, mrd, na

Details for d2vy0a_

PDB Entry: 2vy0 (more details), 2.16 Å

PDB Description: the x-ray structure of endo-beta-1,3-glucanase from pyrococcus furiosus
PDB Compounds: (A:) endo-beta-1,3-glucanase

SCOPe Domain Sequences for d2vy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vy0a_ b.29.1.2 (A:) Beta-1,3-glucanase {Pyrococcus furiosus [TaxId: 2261]}
mvpevieidgkqwrliwhdefegsevnkeywtfekgngiaygipgwgngeleyytennty
ivngtlviearkeiitdpnegtflytssrlktegkvefsppvvveariklpkgkglwpaf
wmlgsnirevgwpncgeidimeflgheprtihgtvhgpgysgskgitraytlpegvpdft
edfhvfgivwypdkikwyvdgtfyhevtkeqveamgyewvfdkpfyiilnlavggywpgn
pdattpfpakmvvdyvrvysfvsg

SCOPe Domain Coordinates for d2vy0a_:

Click to download the PDB-style file with coordinates for d2vy0a_.
(The format of our PDB-style files is described here.)

Timeline for d2vy0a_: