Lineage for d2vrva_ (2vrv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005860Species Saccharopolyspora erythraea [TaxId:1836] [225746] (6 PDB entries)
  8. 2005866Domain d2vrva_: 2vrv A: [304556]
    automated match to d2jjpa_
    complexed with cl6, hem

Details for d2vrva_

PDB Entry: 2vrv (more details), 2.3 Å

PDB Description: Structure of histidine tagged cytochrome P450 EryK in complex with inhibitor clotrimazole (CLT)
PDB Compounds: (A:) cytochrome p450 113a1

SCOPe Domain Sequences for d2vrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrva_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
idevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrvi
egasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvd
vlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltayl
karcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtl
dehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvl
sanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrl
tvdrdderlrhfeqivlgtrhlpvlagsspr

SCOPe Domain Coordinates for d2vrva_:

Click to download the PDB-style file with coordinates for d2vrva_.
(The format of our PDB-style files is described here.)

Timeline for d2vrva_:

  • d2vrva_ is new in SCOPe 2.06-stable